DPCfam | MC118327
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 329 ± 23 aa |
| Residues in low-complexity regions (%) | 2.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18962 |
| Sequences matching dominant architecture (%) | 51.52 |
| Average overlap percent | 20.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000697B45E | 265-611 | 347 | LLGNVDTLVFNIRYESGCVWPGDTDDNTKANNFDLLPIALAYGTLGGARAGASINWTGQSSSDWNLPLALPVLPDYKFIDCNGDG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q06852-F1 | 399-496 | 28.02 | 86.31 | View in AlphaFoldDB ↗ |