DPCfam | MC117990
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.66 |
| Predicted disordered residues (%) | 4.15 |
| Average transmembrane regions | 1.75 |
| Dominant Pfam architecture(s) | PF03189 |
| Sequences matching dominant architecture (%) | 97.51 |
| Average overlap percent | 33.44 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H9GH70 | 476-550 | 75 | PSIRRKILQNISILLIFYNISVWILYAYGTRPHLVSQIEQSFYGFTLWAIVVKISLPLGIFYRMHSVASLFEVYC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E1JJE6-F1 | 895-987 | 98.94 | 82.27 | View in AlphaFoldDB ↗ |