DPCfam | MC117986
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 191 ± 17 aa |
| Residues in low-complexity regions (%) | 4.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00760 |
| Sequences matching dominant architecture (%) | 32.42 |
| Average overlap percent | 29.31 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B0H5Z9 | 26-212 | 187 | SLDDQRKTFLAAEKAWQEDDTESYEKLKSSLGDYPLRLYLDYAELKKRFGKAYNKEIENFIEANRDSAPGQKIRIRYLNRLADRK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0AGC3-F1 | 26-211 | 98.94 | 94.49 | View in AlphaFoldDB ↗ |