DPCfam | MC117912
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Residues in low-complexity regions (%) | 0.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09979 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 41.14 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E7RSH0 | 1-84 | 84 | MYLIDHVPVSAPRRTADGYLVADAYVARTGIQTYLGEELGRPDLLNVRVYRPPEEVFSDATLRSFAHRPMTNDHPPEQVNAQNW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44180-F1 | 8-82 | 92.59 | 87.00 | View in AlphaFoldDB ↗ |