DPCfam | MC117878
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 411 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Residues in low-complexity regions (%) | 6.79 |
| Residues in coiled-coil regions (%) | 0.34 |
| Predicted disordered residues (%) | 1.22 |
| Average transmembrane regions | 2.84 |
| Dominant Pfam architecture(s) | PF12166 |
| Sequences matching dominant architecture (%) | 0.35 |
| Average overlap percent | 27.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J7N2Y3 | 1-91 | 91 | MFLCDFFNFLLLIFGFSAFGTQQGDGGVTAYFQENRVPMPFLLMLLLQFALIVIDRALFLRKSIVGKLIFQYCLVFGVHLWMFFI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QBN7-F1 | 25-135 | 99.11 | 83.67 | View in AlphaFoldDB ↗ |