DPCfam | MC117572
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 167 ± 15 aa |
| Residues in low-complexity regions (%) | 2.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.41 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF12627- PF12626 |
| Sequences matching dominant architecture (%) | 83.9 |
| Average overlap percent | 74.04 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F9ZK69 | 261-416 | 156 | LRMRGLHHGLLPMLDVILEQPLGERFITIALKNTDERVRQNKPVSPGFLFAILLWHEVLSHWNSLQASGEKPLPALFEAMNHILS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HV72-F1 | 261-431 | 98.84 | 95.31 | View in AlphaFoldDB ↗ |