DPCfam | MC117506
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 61 ± 11 aa |
| Residues in low-complexity regions (%) | 0.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07716 |
| Sequences matching dominant architecture (%) | 78.95 |
| Average overlap percent | 2.43 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182ZTF3 | 162-246 | 85 | VEFQVSQQDLALTSIPDYGEDSTPYVPKWKVWTEENRKKNGSDEFDPRRRNFTEEELKPQPIIKKSKKVFVPEDLKDDRYWARRN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BW74-F1 | 169-225 | 98.28 | 92.48 | View in AlphaFoldDB ↗ |