DPCfam | MC117356
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.55 |
| Predicted disordered residues (%) | 60.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12848 |
| Sequences matching dominant architecture (%) | 68.12 |
| Average overlap percent | 42.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4HFJ7 | 494-563 | 70 | KQRENLKSQVAAMTKSAAQSKDEKKMQQAASRRKKLEDRTGMEKNAKGHRFKLNRDLAGFHLTSRAEVDF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q5Z0-F1 | 403-477 | 98.68 | 79.24 | View in AlphaFoldDB ↗ |