DPCfam | MC117332
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.7 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF03466 |
| Sequences matching dominant architecture (%) | 98.0 |
| Average overlap percent | 41.56 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S2LA58 | 17-89 | 73 | GFSNQIGLILELVARGLGFTVLPYYARQAFAHREEIQVVEGSPPVVDKLWLVHHAEWPLSSRAQLALEYLRSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6HPH4-F1 | 212-280 | 89.47 | 95.11 | View in AlphaFoldDB ↗ |