DPCfam | MC117202
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Residues in low-complexity regions (%) | 10.61 |
| Residues in coiled-coil regions (%) | 1.71 |
| Predicted disordered residues (%) | 29.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17196 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 93.71 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000568A03B | 1-61 | 61 | MAIVDPLVLRRLVERYTAVTAGVPGPGQREDLEYTLCVYCGVRDIEAALARANEILGAPPT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P26039-F1 | 856-904 | 72.73 | 81.07 | View in AlphaFoldDB ↗ |