DPCfam | MC11720
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 236 ± 34 aa |
| Residues in low-complexity regions (%) | 7.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05225 |
| Sequences matching dominant architecture (%) | 5.56 |
| Average overlap percent | 14.67 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00099FA318 | 9-258 | 250 | QCTIERRGFRQDLDSWRHKLIHCVGFESILEGLFGSRLVEDLTLFKGSEPEGGTDWSFDENCLFCCVRRDKVKEHLVGLNNQGLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZJK5-F1 | 22-257 | 91.89 | 58.95 | View in AlphaFoldDB ↗ |