DPCfam | MC117096
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 450 ± 52 aa |
| Residues in low-complexity regions (%) | 4.7 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 19.0 |
| Average transmembrane regions | 1.06 |
| Dominant Pfam architecture(s) | PF13975 |
| Sequences matching dominant architecture (%) | 23.91 |
| Average overlap percent | 20.17 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A016ULP4 | 1057-1461 | 405 | DPTWAARTLLQKSDVSATLANDDLLVTRCRNVEATHVYLDHKVNGTCYNLLPVQINEQLWFSIPGTRDLVQMSTEKSCPYVPILH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0K0EP90-F1 | 179-404 | 55.00 | 70.39 | View in AlphaFoldDB ↗ |