DPCfam | MC117074
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Residues in low-complexity regions (%) | 4.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004972E7D | 1564-1646 | 83 | FPSLRTISRVSWCFLKYTKPNSSPAGLHSSVYSSWSINSYNPNPLNLSTKTSLALLRSKQRRNTDLVYTTAVLSPPSSGKLVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5T1R4-F1 | 1595-1679 | 100.00 | 41.06 | View in AlphaFoldDB ↗ |