DPCfam | MC116983
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Residues in low-complexity regions (%) | 1.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11962 |
| Sequences matching dominant architecture (%) | 96.15 |
| Average overlap percent | 34.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J8GLJ0 | 578-650 | 73 | LNPEWDSSQEYIPRLQRPEWVPVGLVGKLLVRDDGTCQVDGYCKSNDEGIATTSTKGYRVMKRTGPNQIMILV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34433-F1 | 725-793 | 90.79 | 93.80 | View in AlphaFoldDB ↗ |