DPCfam | MC116951
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 128 ± 11 aa |
| Residues in low-complexity regions (%) | 8.4 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 0.74 |
| Average transmembrane regions | 3.86 |
| Dominant Pfam architecture(s) | PF05232- PF05232 |
| Sequences matching dominant architecture (%) | 94.9 |
| Average overlap percent | 98.14 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7DII8 | 1-129 | 129 | MDDKTTKSFVIATFDFIGILPIAGFALVLFDQPPTHAFYFGILATLIARVWAIIYDWKWGMLEDTHHSDTGWGDRLMNLAGFELV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZW7-F1 | 27-154 | 98.46 | 90.91 | View in AlphaFoldDB ↗ |