DPCfam | MC116673
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 178 ± 31 aa |
| Residues in low-complexity regions (%) | 4.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.85 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1XQX1 | 2003-2189 | 187 | VMGGGRLHVSLDLGPLQAWFDAWADFLINYKPFHFMAEGGISVGVRFELDLWFVTITIEVDISATLYLEGPPVAGTVHVDFWVFG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CWK2-F1 | 2029-2230 | 97.86 | 70.84 | View in AlphaFoldDB ↗ |