DPCfam | MC11666
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 651 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Residues in low-complexity regions (%) | 2.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13298 |
| Sequences matching dominant architecture (%) | 96.0 |
| Average overlap percent | 73.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F0SIB6 | 3-131 | 129 | RFVILEHDHPTLHWDLLLDNGEQRVPTWRLTQAPSEQPQLEAGMRFAAKAANMEKIDAVKLPDHRRMYFDYEGPVSGDRGQVTRW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I1X7-F1 | 36-159 | 97.48 | 91.74 | View in AlphaFoldDB ↗ |