DPCfam | MC116323
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 202 ± 9 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.94 |
| Predicted disordered residues (%) | 12.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00563- PF10388 |
| Sequences matching dominant architecture (%) | 93.94 |
| Average overlap percent | 52.51 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006EC31B8 | 207-410 | 204 | VLSISELVQRAGCELICEGVETEQEFHFGVECGARYMQGWLFYQAQPDFLVAQMSQAKVKTLLGSYLKRKSSRTSATIKHNVAVK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O35014-F1 | 198-397 | 99.50 | 94.61 | View in AlphaFoldDB ↗ |