DPCfam | MC116284
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Residues in low-complexity regions (%) | 3.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.59 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF07171 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 53.49 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7PQI7 | 336-432 | 97 | DGEAAKAAVDAGVDAVLDISVGGRTDPESGAPVPGPWRVVAVGDGQFTGVGPMYAGASIEMGPVALLEQAGVRVIVAGRRMQASE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q93CA6-F1 | 373-455 | 98.86 | 96.45 | View in AlphaFoldDB ↗ |