DPCfam | MC11597
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 320 ± 54 aa |
| Residues in low-complexity regions (%) | 10.85 |
| Residues in coiled-coil regions (%) | 10.17 |
| Predicted disordered residues (%) | 62.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06839 |
| Sequences matching dominant architecture (%) | 77.57 |
| Average overlap percent | 12.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S6X8U1 | 42-346 | 305 | KGLFTDGQWRCDCDPRLPAEHFRVKKDGPNHGRWFYTCQNAQALRCGFFLWDEEAKPRMESAVLNNSRTEAGREQDTAQVAAQTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GT67-F1 | 38-472 | 96.99 | 59.70 | View in AlphaFoldDB ↗ |