DPCfam | MC115680
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Residues in low-complexity regions (%) | 3.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S6C8T0 | 190-246 | 57 | VQLMLHLQGICKPCAFYYNKKKGCRNGNSCGFCHHEDHSLSTLKQWKKQQRLYSQSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZDJ6-F1 | 215-241 | 46.55 | 81.81 | View in AlphaFoldDB ↗ |