DPCfam | MC11561
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 85 ± 14 aa |
| Residues in low-complexity regions (%) | 1.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07039 |
| Sequences matching dominant architecture (%) | 91.23 |
| Average overlap percent | 23.85 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183I7R0 | 1-72 | 72 | MQMLSHNARTAPLWIGPPDTHPPVLVGAIPALVSMSLKVGMEVAAFIDGIWMLAEITSVFAASKYEVKDIDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QQW7-F1 | 113-202 | 98.88 | 92.37 | View in AlphaFoldDB ↗ |