DPCfam | MC115470
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 720 ± 113 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.25 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF07728 |
| Sequences matching dominant architecture (%) | 13.6 |
| Average overlap percent | 12.12 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A087X3Z5 | 1426-2256 | 831 | NLLICPHDQVLTSSICLYMNSEYEPLPSYDEVLLCTPSTSYEQVELFLRRCLTPGDVGQKVYTMIWADQLAYDVSCAMEKCFQRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7PBI1-F1 | 536-597 | 8.39 | 86.78 | View in AlphaFoldDB ↗ |