DPCfam | MC115359
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 302 ± 23 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01968 |
| Sequences matching dominant architecture (%) | 97.39 |
| Average overlap percent | 74.04 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7YRI5 | 241-552 | 312 | TIGWDLGGVHVKAARIVAGRVVDAAQVPCPLWQGVPALDGALAALPDWARADAQHAVTMTGELTDCFADREAGVAALSGWAAAQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58250-F1 | 5-298 | 99.34 | 95.79 | View in AlphaFoldDB ↗ |