DPCfam | MC115310
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Residues in low-complexity regions (%) | 5.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.27 |
| Average transmembrane regions | 1.03 |
| Dominant Pfam architecture(s) | PF08118 |
| Sequences matching dominant architecture (%) | 84.31 |
| Average overlap percent | 60.98 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H8X4F7 | 84-213 | 130 | KITKAALLAQADSRLSRLWINVKWPLVRGSKTSKLDISSAFISGMVMGNLLWIILGTTTFGLMVMYSLHYLDNIIDSAKEKTPKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0P145-F1 | 223-336 | 99.13 | 76.16 | View in AlphaFoldDB ↗ |