DPCfam | MC115238
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Residues in low-complexity regions (%) | 2.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.92 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12110 |
| Sequences matching dominant architecture (%) | 99.12 |
| Average overlap percent | 39.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A085MJP0 | 1468-1566 | 99 | PPYSSFAGDIKVEPSLDVRYHLLKLYSSRTHPIQSLLCTLTWTNSPFNFHLSWFLWCVMSALGFSNFSENAVTSLHLAYAAQLEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P52948-F1 | 1466-1574 | 99.07 | 78.06 | View in AlphaFoldDB ↗ |