DPCfam | MC11501
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Residues in low-complexity regions (%) | 1.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09362 |
| Sequences matching dominant architecture (%) | 99.48 |
| Average overlap percent | 27.98 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S3CLQ9 | 290-365 | 76 | SAQAGLRFPCSELTVQRLDPVVQPGAIPSTHVHHIVGGNAFNATMNGDVGERATCTTCQMSEDFSNYWTAALYFKH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GPX9-F1 | 20-96 | 98.73 | 95.93 | View in AlphaFoldDB ↗ |