DPCfam | MC114948
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Residues in low-complexity regions (%) | 3.09 |
| Residues in coiled-coil regions (%) | 0.17 |
| Predicted disordered residues (%) | 0.14 |
| Average transmembrane regions | 2.65 |
| Dominant Pfam architecture(s) | PF13440 |
| Sequences matching dominant architecture (%) | 1.33 |
| Average overlap percent | 2.75 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W6MJZ9 | 348-425 | 78 | LFKWQLAGDLIKIVTTVMAFRFIAQNQLKKYLIAEIASVGFFVIISYLIIPIYQEEGVVIAYFLNYVFYVLVLISLLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GLL0-F1 | 330-409 | 96.39 | 87.32 | View in AlphaFoldDB ↗ |