DPCfam | MC114742
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Residues in low-complexity regions (%) | 1.53 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 24.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00923 |
| Sequences matching dominant architecture (%) | 96.89 |
| Average overlap percent | 45.97 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146I7U2 | 204-318 | 115 | SVKRIFNYYKQYGYNTIVMGASFRNVGEIKALAGVDFLTIAPSLLEELKSSTEPVPQKLNAQAAAAADPIPKVSYIDNEPEFRWA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G4LZK0-F1 | 202-321 | 99.15 | 95.58 | View in AlphaFoldDB ↗ |