DPCfam | MC114236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 291 ± 31 aa |
| Residues in low-complexity regions (%) | 1.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.87 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF14088 |
| Sequences matching dominant architecture (%) | 74.29 |
| Average overlap percent | 41.23 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7LM37 | 3-294 | 292 | LGKIKRINDLRSVWQHETKDFSKWLAQECNLQQLSDAIGIDIVLEECESSVGSFNVDLYAIEEGTERRIIIENQLEDTNHDHLGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZK05-F1 | 4-152 | 37.89 | 84.10 | View in AlphaFoldDB ↗ |