DPCfam | MC114219
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 391 |
|---|---|
| Mean domain length (aa) | 298 ± 33 aa |
| Residues in low-complexity regions (%) | 3.18 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 11.15 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14500 |
| Sequences matching dominant architecture (%) | 96.84 |
| Average overlap percent | 84.05 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158R879 | 4-259 | 256 | LLNLVEFLNEGLTNPDSSVQKDAFRQLNDGIRSQPSKNFTDAEVEFYVSRLVLPDPDLIGIILEGILWFAQHQLLSADCAVKICS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GFV5-F1 | 34-322 | 98.99 | 93.39 | View in AlphaFoldDB ↗ |