DPCfam | MC11411
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Residues in low-complexity regions (%) | 1.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08661 |
| Sequences matching dominant architecture (%) | 95.82 |
| Average overlap percent | 93.45 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A084FZF0 | 3-86 | 84 | ERTSTPRVTAQYLSSYTGQNVIVVGKVLQLRGDSALLDSQGNVTLNLNRDAHLINGNAAQVIGKVNPDLSIKVLTSKDLGDNLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9CQ71-F1 | 8-110 | 97.98 | 97.32 | View in AlphaFoldDB ↗ |