DPCfam | MC114010
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 781 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.54 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09323 |
| Sequences matching dominant architecture (%) | 27.19 |
| Average overlap percent | 7.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D9P4U5 | 82-192 | 111 | DVDLTSLSKTMVYSQVYNMMFYPENFIGKTIRMEGIYTEYFDQATGKRYLACFIMDATQCCSQGVEFELTSDYSYPDDYPTEGDT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8DQ82-F1 | 158-268 | 99.09 | 90.87 | View in AlphaFoldDB ↗ |