DPCfam | MC11386
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 58 ± 7 aa |
| Residues in low-complexity regions (%) | 6.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.76 |
| Average transmembrane regions | 0.81 |
| Dominant Pfam architecture(s) | PF13520 |
| Sequences matching dominant architecture (%) | 1.3 |
| Average overlap percent | 7.61 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G2XG23 | 76-136 | 61 | RTFRNLSSRTRIGVGIGIIGWGLAGHYLADRAEETYKAPAEDKAVVDRYVPRVTVVDRREG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GS40-F1 | 2-48 | 87.04 | 94.48 | View in AlphaFoldDB ↗ |