DPCfam | MC113513
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 149 ± 26 aa |
| Residues in low-complexity regions (%) | 5.67 |
| Residues in coiled-coil regions (%) | 0.88 |
| Predicted disordered residues (%) | 8.16 |
| Average transmembrane regions | 3.11 |
| Dominant Pfam architecture(s) | PF14936 |
| Sequences matching dominant architecture (%) | 90.0 |
| Average overlap percent | 87.02 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3BF93 | 1-145 | 145 | QISQMLGNEIKFAVREPLGLRLWQFASALMFTGVAVMALTFPDRLYDTIFDEVAAGGSKMSVRLYGGALFSLSLIMWNALYTSEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0VCQ8-F1 | 10-180 | 100.00 | 77.82 | View in AlphaFoldDB ↗ |