DPCfam | MC113493
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Residues in low-complexity regions (%) | 1.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13715 |
| Sequences matching dominant architecture (%) | 8.22 |
| Average overlap percent | 0.98 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C1DN93 | 102-272 | 171 | VLIKGTKLKERIVGQQSRPMITFSKMFDKNVPSIEQGNIFEIYNRTLLKAYNFYIMPSSRFSAITLKLNVYTVKNNLPDSNVLRK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8DRK2-F1 | 1017-1067 | 30.72 | 78.71 | View in AlphaFoldDB ↗ |