DPCfam | MC113467
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 731 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Residues in low-complexity regions (%) | 2.58 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 15.33 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02847 |
| Sequences matching dominant architecture (%) | 80.37 |
| Average overlap percent | 84.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J7HXL0 | 1591-1706 | 116 | ERLQDMSMSAIREYYSARDDKEVALCIKELNSPSFHPSMVSLWVTDSFERKDTERDLLAKLLIHLVKSQDGTLSQANLIKGFESV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6LEN8-F1 | 300-418 | 97.58 | 90.85 | View in AlphaFoldDB ↗ |