DPCfam | MC1133
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 154 ± 30 aa |
| Residues in low-complexity regions (%) | 10.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11035 |
| Sequences matching dominant architecture (%) | 88.0 |
| Average overlap percent | 50.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1KZ52 | 187-330 | 144 | VDFEKIYKYLSVISRGSKAPELPPGESAVLLDLLLSLPEELECLDFNKLKSHMYKCYRELNGRYTGNKNGTQAESSQSVNSGRDQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q13487-F1 | 202-284 | 54.90 | 76.42 | View in AlphaFoldDB ↗ |