DPCfam | MC113194
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 182 ± 30 aa |
| Residues in low-complexity regions (%) | 4.99 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 34.5 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150VEM6 | 661-839 | 179 | GKLTKMRVLLYVHRPFIYCFLFENRTSSLQLRRFYYTLHRNLVPIHRPLLSSTSAERVSQRIETSQIGLVEEDDASSVRSRGTNR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1HAH9-F1 | 543-721 | 95.60 | 78.47 | View in AlphaFoldDB ↗ |