DPCfam | MC113110
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 103 ± 17 aa |
| Residues in low-complexity regions (%) | 0.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01139 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 26.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W9U984 | 78-165 | 88 | LQAAGNYAYANRLAVLAALRDALRSVWGADCDSPDLLWDAPHNGIRREIIGDRKLWVHRHNAVRVEPPSQTPAHSPFAQTGHPVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5JCZ1-F1 | 287-392 | 99.05 | 97.61 | View in AlphaFoldDB ↗ |