DPCfam | MC113054
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Residues in low-complexity regions (%) | 7.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18934 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 13.97 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A1VTQ8 | 711-793 | 83 | PLKAAAWLEGFLNRNALVLLHDAALWQLVDDWLCGLGEEHFVHILPLVRRTFSTFSASERSDLGQRARQGVRPVQAVASAPGW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F5V5-F1 | 680-757 | 95.12 | 88.72 | View in AlphaFoldDB ↗ |