DPCfam | MC112896
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 95 ± 13 aa |
| Residues in low-complexity regions (%) | 2.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11709 |
| Sequences matching dominant architecture (%) | 93.23 |
| Average overlap percent | 40.21 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067MAE6 | 7-87 | 81 | SQFSALLRRSKFASFDPQIAQVYTSYGGHSHRGQFGLKRSLPSRARTRNPLILVSAVDTPEHQTEWRHGADEGKWIKRWEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GSB7-F1 | 9-118 | 95.35 | 91.06 | View in AlphaFoldDB ↗ |