DPCfam | MC112536
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 20271 |
|---|---|
| Mean domain length (aa) | 622 ± 83 aa |
| Residues in low-complexity regions (%) | 2.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07715- PF00593 |
| Sequences matching dominant architecture (%) | 76.57 |
| Average overlap percent | 89.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008C662A0 | 21-790 | 770 | MSLTSVGVSAAEAQATEKGKIEVIEVTANRRTQTLQEIPYNISAVSGQELEDAGIIDASQLMRNVAGITVVDRGYRNSGAVNGVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P17315-F1 | 34-589 | 95.28 | 93.75 | View in AlphaFoldDB ↗ |