DPCfam | MC112523
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2741 |
|---|---|
| Mean domain length (aa) | 244 ± 30 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09587 |
| Sequences matching dominant architecture (%) | 92.52 |
| Average overlap percent | 89.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1T5C7S9 | 19-278 | 260 | LAAARPAYPWGDTLAVLERADVRIANLECVLAAGGEPEPGKIFHFRSDPKNVASLLAAGIDAVSLANNHVLDFGQDAFGEMLPAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P19579-F1 | 81-313 | 95.38 | 96.41 | View in AlphaFoldDB ↗ |