DPCfam | MC112406
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 349 ± 50 aa |
| Residues in low-complexity regions (%) | 11.6 |
| Residues in coiled-coil regions (%) | 1.98 |
| Predicted disordered residues (%) | 61.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15552 |
| Sequences matching dominant architecture (%) | 59.09 |
| Average overlap percent | 75.92 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00044022AE | 1-252 | 252 | MAVGDSSLATSPGLSQDSLNFEPMRSAEPLALGAMEPPAHLSRLLASRKLEQVLERSCQLPTSSASLSHYRSPKPPSNPECEMPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NAV2-F1 | 45-356 | 96.81 | 54.49 | View in AlphaFoldDB ↗ |