DPCfam | MC112339
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 173 ± 23 aa |
| Residues in low-complexity regions (%) | 2.15 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 28.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04860 |
| Sequences matching dominant architecture (%) | 67.35 |
| Average overlap percent | 25.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A0RM05 | 58-225 | 168 | ASKKEESQEVTGYNAFQVMLPPYNLDYLAKLYEVSSPHYSAVKAKVSNIVGLGFDLVETPAAKRKLDEIEGEDKTKKARKKIAIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45917-F1 | 25-213 | 96.93 | 94.26 | View in AlphaFoldDB ↗ |