DPCfam | MC112218
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 262 ± 32 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R2AN86 | 296-498 | 203 | NNLSKIQKAVQISPLINVGHGQTLSWNPKTQHLYLAQDESLKDLTPGQNNNVTELDPDTLEPIRQYHFRLQQGGTSMQMHTLTFD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32F51-F1 | 46-211 | 49.06 | 98.62 | View in AlphaFoldDB ↗ |