DPCfam | MC112148
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 138 ± 21 aa |
| Residues in low-complexity regions (%) | 2.0 |
| Residues in coiled-coil regions (%) | 2.47 |
| Predicted disordered residues (%) | 23.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02865- PF01017 |
| Sequences matching dominant architecture (%) | 49.62 |
| Average overlap percent | 50.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P52630 | 1-154 | 154 | MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLFFHFLDQLNYECGRCSQDPESLLLQH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42230-F1 | 1-153 | 98.68 | 86.04 | View in AlphaFoldDB ↗ |