DPCfam | MC111964
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 140 ± 8 aa |
| Residues in low-complexity regions (%) | 2.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07433 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 48.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7APT0 | 226-370 | 145 | IRHLDVSPDGTVVFGAQYQGEKTDIHPLVGMHRRGESVQAMNGSDEHWLSLGQYVASVACFPDNQTAVITSPRGNIVQFWDLASR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HW29-F1 | 221-362 | 99.29 | 95.86 | View in AlphaFoldDB ↗ |