DPCfam | MC111733
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 94 ± 17 aa |
| Residues in low-complexity regions (%) | 3.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04185- PF05506 |
| Sequences matching dominant architecture (%) | 47.5 |
| Average overlap percent | 20.5 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A076MUB5 | 331-441 | 111 | LERRFGVHEPNISPWRRAICGDLTAAFDFSRTDAAVPGLPGTDGYYPPDRERHPDYVPAPPADPALPRQERGQRPALPLPYDLTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P15713-F1 | 414-505 | 96.88 | 91.09 | View in AlphaFoldDB ↗ |